DPCstruct | MC22218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6F268 | 182-302 | VKGENPFVEESYQRVALDQLIKIAGITDDDLLIMSDVDEIPSGHTIDLLRWCDDVPEILHLQLRNYLYSFQFLLDDKSWRASVHRYR… |
| A0A6P6YDA4 | 219-360 | LESNENPFVNEIRMRNCMTWTIRSLAKPEDLIIVGDVDEIPRQSTIELFRKCIGYPEIVHLQMKTYFYSFEFYYSSDDFWQSKIQIY… |
| A0A7J6LCD6 | 179-330 | None |
| A0A146ID63 | 158-284 | None |
| A0A835I1V4 | 174-302 | None |
| A0A7J7GYU1 | 1-104 | None |
| A0A438D1V9 | 142-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.