DPCstruct | MC22215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5GU51 | 66-172 | SITDSTFLQTKRPMSDDAIAPYNYKTGFVEDRAYNQVIYIKALERVKSHLSIKKGLLICDLKSGVEIRISEDLFQYIMDLLNNWNLG… |
| A0A416VVL1 | 2-110 | NKDSVFLDIKGNLLEDPSLLWKNKDVYDKALERMEKHLSIVNGRFKWDITSGKSINVSENLYDYIVQYWNHENSLLEDEDYMILRFK… |
| A0A396M867 | 3-105 | None |
| A0A7W6I051 | 129-232 | None |
| A0A0C3RDY6 | 30-136 | None |
| A0A0C3R4W3 | 26-140 | None |
| F7M4N4 | 147-255 | None |
| A0A6L3K0F1 | 175-280 | None |
| J9CZI2 | 238-343 | None |
| A0A3Q9IS72 | 16-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.