DPCstruct | MC22212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 19.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800DQL2 | 279-348 | RAVIDEFEQNRDAYEQEEASLLEKYNGQFVAFCHGKLVAVGPDRKQVIQEAMQAEPTARPYIRQVGVEIP |
| A0A554MEF8 | 1-74 | MARNALKIEFEFYLRNQTKLVKKYNGRYLLIFGNRVRGDFESYDSAYIFGSKKYKLGKFLIQKCSPGEEDYAAN |
| A0A661EH50 | 4-74 | None |
| X1T9F4 | 26-94 | None |
| A0A1G1INA6 | 8-77 | None |
| A0A6B1BB54 | 89-166 | None |
| A0A6L7LWB7 | 10-80 | None |
| A0A0F9SVL4 | 32-107 | None |
| X1D9Z1 | 5-78 | None |
| A0A2N2PYQ2 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.