DPCstruct | MC22205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 148 ± 32 aa |
| Standard deviation of domain lengths | 31.66 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 77.49 |
| Assigned Pfam label(s) | PF01977- PF20696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3F4G8 | 11-149 | YKNVYAHTAGGGKFLGILQVKKRQPADEGRQGQAALLALATYSELKNIILVDEDVDIFDSDDILWAMTTRMQGDVSITTIPGIRGHQ… |
| A0A4R5NDZ9 | 327-483 | EHVSMAGIPTEASILELVDKAIPGKVVNVYNPPAGGGKLMTIMQIHKDNEADEGIQRQAAILALSAFKELKTVFLVDEDVDIFDMND… |
| A0A1B0C782 | 323-471 | None |
| A0A133UX92 | 18-170 | None |
| A0A167NXY0 | 307-483 | None |
| A0A7C1BK74 | 1-110 | None |
| A0A1V5C7V3 | 2-93 | None |
| A0A3S4JVF7 | 129-289 | None |
| A0A5V4GKA9 | 512-667 | None |
| A0A377LUH1 | 6-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.