DPCstruct | MC22201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 117 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 13.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354RF03 | 3-106 | ILQEEKSPNGQLVATSFSSSGGGAAGYFHFNANLRKVDDKLHAPDVLMGKHPRWMAFYDIDVRWVDDQNLEVSYKQDQSPVYKENNA… |
| E8WVC6 | 46-171 | AAIPLLIATALIFFALNYTRHLPQQISPDGRLIAITTYTVNNGTGVDQAEISIRHPWNPYAHRVYAGPAEYKPNAKTPDPEAQWLDS… |
| A0A7W9AJE5 | 1-132 | None |
| A0A1S8FMT1 | 119-244 | None |
| A0A4Q3B8C7 | 1-118 | None |
| A0A6I4TTJ5 | 11-135 | None |
| A0A2V9TIX3 | 1-101 | None |
| A0A5D8YR43 | 196-297 | None |
| A0A7X8F106 | 15-114 | None |
| A0A841JVK3 | 24-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.