DPCstruct | MC22200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 287 ± 59 aa |
| Standard deviation of domain lengths | 58.62 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0Q7U8 | 3-212 | GLTGECLSGDLLTAVIWSWFAATDSHSRLSQRAAGMVENPGLSYGLFHAVAQPVYSWGVVCRVEFPGVNIDIGHIRNLAWSRNNDKA… |
| A0A4R8GJ96 | 1-300 | MIDGQVVATGDAVKMGTKQSFQMKFSYPSYVGLPDDIINNEVTAGASYVVTLNTGKIDSEQLNEKLTALKETEQNLENENYDDLQSE… |
| G8LWN6 | 574-882 | None |
| A0A1V1P5S1 | 120-384 | None |
| A0A250KVJ8 | 181-481 | None |
| A0A290ZQ42 | 413-668 | None |
| A0A373PSV1 | 474-739 | None |
| A0A6I1KMF9 | 208-466 | None |
| A0A1V4Z8U8 | 632-926 | None |
| A0A831Z6V2 | 2-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.