DPCstruct | MC2220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N6MI50 | 55-151 | VTEDGEDLEPLDVGDYVVPDGRDATTVVMCCSDRTAGEYFVERIDETVAEYNECDPDERVYEVVFANRTDKDLADCKRYPYPRSALT… |
| A0A830GRL8 | 110-206 | SEDADPPHLCGNCRVLPGDVVVDRETGDSLVVAGVSEDRADEYVIEATGRTVAAHDTNEGYPPDDIVVEVTYLADATRRDDPRRYAF… |
| A0A1H6XDF6 | 69-154 | None |
| A0A7J9SM27 | 9-135 | None |
| A0A6A9SFY0 | 2-99 | None |
| A0A1N7EJD5 | 5-109 | None |
| A0A1H4ACI5 | 158-263 | None |
| A0A1H8S486 | 35-120 | None |
| A0A2B7GU36 | 48-143 | None |
| A0A1H8W9V0 | 41-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.