DPCstruct | MC222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 311 ± 33 aa |
| Standard deviation of domain lengths | 32.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662WHG7 | 397-687 | SIESRSPDDQSALFRRVQQLEKQLQQAGIVVAADISYDEALAKVQAIALRMGEIGSSDVEHPDPAIQKQLREEYYLMEQEMEKFNAA… |
| T0PY92 | 99-379 | VPLPVSTPRNDPVMDRLVAIMRPNDSYDELTRRIQEISRRMRAIGTADVTHPDPLVQRDLREEYFVLEQDMEACHDAIQHKPEYAIE… |
| A0A6G0XUI4 | 17-302 | None |
| A0A1V9YLG4 | 75-449 | None |
| A0A7S3PG07 | 1-280 | None |
| M4C6T0 | 10-301 | None |
| A0A7S0UMQ6 | 130-509 | None |
| A0A482S9B9 | 236-568 | None |
| D7FM20 | 5-277 | None |
| A0A7S4E5B8 | 67-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.