DPCstruct | MC22197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 204 ± 20 aa |
| Standard deviation of domain lengths | 19.58 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13308 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E2H4B6 | 209-421 | EDSLTFPDVFSRYLSRADLCLWPTENLWLLRNEIYAANGRQFKSDVLSQYFSEKRWYRGIIAPDSFSDSILSDVESGNISFIQKMEN… |
| A0A844J3U7 | 173-369 | YIFPESSTGYLTGGDLLDADPSMLRLARNEIYARHGRKFDAADLQEYFNSKSWYHAETSPADFKEDVLNEFEKKNLELIKTAESQLP… |
| A0A6N2VY44 | 36-252 | None |
| A0A1Y4ET44 | 182-368 | None |
| A0A660SIF2 | 4-232 | None |
| A0A5B1B175 | 1-211 | None |
| R6RWJ1 | 33-245 | None |
| A0A2V3XU52 | 377-575 | None |
| F2NVE0 | 204-398 | None |
| A0A3T0D4G4 | 15-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.