DPCstruct | MC22194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4KPW4 | 24-176 | EKLQVVFQKAQQMQKADRKGKICTMGISYLQSSVLTENYELRIDLYDKEFYLDSAECCTYWKPEFITGYLLQDVEYFKKEIRFKIPQ… |
| A0A844J0W8 | 13-157 | IDDFIRAAIERQKTDTWRPAYLSVFYLHSSSLTGTYQYKVRLMNQKMYFDDSFEEFDWFPAFLYGTMEEEKEVLSYELKRKFVRVKE… |
| D4CQG1 | 10-134 | None |
| A0A7X4ZG59 | 15-183 | None |
| A0A351V9H4 | 33-215 | None |
| A0A1Y4MLN9 | 12-149 | None |
| A0A351V7G8 | 59-227 | None |
| A0A172ZIW8 | 2-141 | None |
| A0A7U9MVQ7 | 1-125 | None |
| A0A227L621 | 4-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.