DPCstruct | MC22192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R2WRJ4 | 23-92 | MKAKNIPVTYVLFPDEGHGFRRPENSKAFNAVTESFLSQCLGGRLQPIGADLEGSSITVPEGADKINGLG |
| A0A354NXM4 | 1-77 | MNENGIPVTYALYPDEGHGFARPENNLSFMAITEAFLSRTLRGRLEPIGEAFNGSSVRILNGGDEIPGLDGVVVDSE |
| A0A2V5RJ12 | 1-63 | None |
| K6ZFA2 | 1-61 | None |
| A0A7X7DQS5 | 99-162 | None |
| A0A6C1PIN9 | 102-171 | None |
| A0A843K3S4 | 1-52 | None |
| A0A2D4C0V6 | 1-62 | None |
| A0A530RFR9 | 96-158 | None |
| A0A838UFN6 | 70-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.