DPCstruct | MC2219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 12.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H8HVS6 | 7-128 | RATMRLLATFESLLAASAVYGGVSLIARAPGFAMPVEWLAPLGLTSWVLPGFALVLVVGGSLAAASVFAWRSDFRAPAAALAAGAVL… |
| A0A3N6M6S3 | 3-118 | CLLFLGISAIGGGGQFLLNPTGDIIGMPVDVLAGSPFTDFLLPGMILFTALGLFPLAVLYGLYTERRWAWPAAIMVGIALIVWIVVQ… |
| A0A2N4XE14 | 4-114 | None |
| A0A1I0KI36 | 10-148 | None |
| A0A1F7Z587 | 2-112 | None |
| H9UKZ2 | 4-129 | None |
| A0A543A090 | 11-150 | None |
| A0A1M3LQ82 | 3-134 | None |
| A0A7K0EUX1 | 2-136 | None |
| A0A172RX46 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.