DPCstruct | MC22189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 142 ± 15 aa |
| Standard deviation of domain lengths | 14.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2L5K6 | 1-156 | MNLVKTRDDLEREAPRLKKEWIQKIDSIDDANRKYVLVFEDLVFEADHEQDITSRLIRDYIETDDRNMQLLFRIDFARALSMYSIMN… |
| A0A369AFG0 | 1-175 | MTEEYRIFFNTGNEGEKAVKPELPVILALNGLIYEAASLKGTVAVIVKEAVNEDYLDAGSTETEWHLRVQAARSHVMLAAMMDKEAV… |
| A0A386PG49 | 12-137 | None |
| A0A0L6JP04 | 1-143 | None |
| A0A840QM75 | 3-125 | None |
| A0A4P6BKP1 | 20-155 | None |
| A0A1N7D722 | 6-150 | None |
| A0A3S1BFB3 | 6-143 | None |
| A0A7X7CJ07 | 261-395 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.