DPCstruct | MC22186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 119 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3PTR3 | 1-106 | MTAEALADLLRSDWDNVTAVMIDSPLENLAVFRDAVNGVSVLPGVTVDIDLMAITLGMASDKNVPISDNTVIAVITILGGDPADFNV… |
| A0A0D6PGR5 | 40-162 | EGQETLTMTVAQLYSLSATEFSYIVKTYYASIVRIDSPLENLSLLKSYVLTDASPLSGVAPASQDDMIAIYLGSASDKTIPITSDTV… |
| A0A192IIK4 | 14-130 | None |
| A0A840XRL9 | 156-283 | None |
| A0A7R7JE58 | 378-504 | None |
| A0A2E5C6C4 | 1-98 | None |
| S9QW72 | 13-130 | None |
| A0A849IKU6 | 116-238 | None |
| A0A258NTH3 | 23-149 | None |
| A0A1Z4VMW9 | 265-387 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.