DPCstruct | MC22185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 152 ± 18 aa |
| Standard deviation of domain lengths | 18.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A437R114 | 17-143 | RVYFSSEFLVSPIEHWRLRINSPQPLPGHGENGKVQLEYKYDEQLYQQDVQLHLETAGYDEKLAQHWYVYRLDETATQFWQEYQDVL… |
| A0A2E3PSA1 | 27-188 | LAACGHVPLTSMVKLRAFDLKTTDPEQLMVAVRHPDWIRIPQGGAVMIIEERSAPEGPVVQRDEIVFERIEGAREPAGLASERRNGT… |
| A0A6I6ILH4 | 4-141 | None |
| A0A523QAD3 | 2-158 | None |
| A0A0N7LWK5 | 8-169 | None |
| A0A6B2IAF7 | 63-221 | None |
| A0A2N3BSA3 | 4-152 | None |
| A0A2G2LIF3 | 1-208 | None |
| A0A7D7WLR2 | 15-172 | None |
| A0A5S3UQE5 | 13-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.