DPCstruct | MC22179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 121 ± 9 aa |
| Standard deviation of domain lengths | 9.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10233 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9PT35 | 136-257 | ILCFALGIANIFNKVIVFSIICLASSFVIIFIEIPLLLRICPTSSKFDSFIRRFTTNYMRALMYIILSAVQWLSIIVGTSSLIAAAV… |
| A7TS55 | 36-168 | IVCMALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRCIFYTLMAIVQWCSLALMVTSLIVV… |
| A0A261XT93 | 646-765 | None |
| A0A2G5BF56 | 18-140 | None |
| U7PPE8 | 2-126 | None |
| C1GTK8 | 79-199 | None |
| L7JDK9 | 25-148 | None |
| A0A1V6NF70 | 25-149 | None |
| A0A4U0U107 | 19-147 | None |
| K0KJB3 | 25-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.