DPCstruct | MC22178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 474 ± 131 aa |
| Standard deviation of domain lengths | 130.67 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 71.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UZJ3 | 8-418 | YKEDGVKGVLCETDYLRRLDLLCAKCCCAIRGPHINAVNKKFHVEHFTCDVCNTVLPPSSNYFQNNGNIYCQEHFSELFVNRCSGCH… |
| A0A1J9PQ82 | 1-466 | MHERNGAVPLCETDFFRRLDMLCSECGGALRDLYISALGRKYHMDHFTCHSCQHVIGPGDNYYIHGGKAYCKDEYMAKYADRCYGCG… |
| R8BRT8 | 16-301 | None |
| K9FZK9 | 16-346 | None |
| A0A4S9J6U2 | 68-607 | None |
| A0A420SNC4 | 430-814 | None |
| F8P3R2 | 43-536 | None |
| A0A0A1UL86 | 2-674 | None |
| A0A4S9BZ55 | 133-660 | None |
| A0A1L7W6D1 | 36-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.