DPCstruct | MC22177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 402 ± 71 aa |
| Standard deviation of domain lengths | 71.41 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12520 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6I425 | 12-336 | DRSLRRALLENITSVPSLIPSLGIFFEMLKYLEPICDTLKQLIRTKMKGTIRRSLFGSFFPPEKVTVQKSESHAMELRGQLDKAAEI… |
| A0A1J9P4L7 | 83-549 | WLAPLLRCNRERLEQLDNRRNRRLRQGFDALLAIPGLWGHGMRISMIHRLVAIDCVEEFWSSLVDHDPVAMKRIDQDTVEKLQLIAP… |
| M1WDN3 | 13-671 | None |
| A0A4V3SIE6 | 4-282 | None |
| A0A4V1XSR5 | 2-355 | None |
| A0A2H3FKE2 | 160-649 | None |
| A0A1V8S7G2 | 2-373 | None |
| A0A2K0W6G9 | 19-425 | None |
| A0A7R7W8A1 | 46-443 | None |
| A0A7R7VE23 | 13-441 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.