DPCstruct | MC22170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 376 ± 57 aa |
| Standard deviation of domain lengths | 57.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1K9K6 | 16-299 | GLLLLVVRLANWGLSRSRTLPVPPQANGYEPLVLAAREVKSPSSDLAELSQEQARQLAEENKPVLAMARKSLAMDSGVTLDTKKGWQ… |
| A0A4P5XQU6 | 90-513 | TRMPDRFFKGLGIEPLPDEGKYFQTLGKWIEGRPDVKVDANAVYDMQSKSGERPWKSDEFPLIAAWLKDNEAALQTVAAATERPRYY… |
| A0A517YAK2 | 268-597 | None |
| A0A4P5SY92 | 27-349 | None |
| A0A166VR43 | 16-358 | None |
| A0A7V5ZEW4 | 5-330 | None |
| A0A3C1V8Y7 | 64-489 | None |
| A0A5C7RMN6 | 90-492 | None |
| B9XPJ9 | 345-695 | None |
| A0A812PL34 | 528-942 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.