DPCstruct | MC2217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 126 ± 14 aa |
| Standard deviation of domain lengths | 13.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W8T8Q6 | 15-129 | FMDNKSVQILFTDKQYQDLEKKAAKAGLTVPLYIKGIVLENDEFSLAYAKLIKKVDALPSGTRFTIRSLFGTEWTMGRGIKLSLGKT… |
| F3ZXE5 | 1-127 | MRITIDFDDEFSETIKRESIKNGISLSEFIKRCVQRCINDGIVFKEVENYVDDETIQKILEESLDKLPSKKKFLLQELFGLDWRDLT… |
| Q2VHL1 | 1-114 | None |
| A0A1M6P231 | 1-149 | None |
| A0A374AVP6 | 35-151 | None |
| A0A1E7W6A1 | 63-187 | None |
| A0A839HL86 | 1-133 | None |
| A0A520GGC1 | 1-133 | None |
| D5Q9Z8 | 7-98 | None |
| A0A0Z8HEC1 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.