DPCstruct | MC22167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 296 ± 82 aa |
| Standard deviation of domain lengths | 81.64 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.81 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0378- PF01329- PF02547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P5WUE0 | 1-293 | MNDTQVLPARLRGRRLETGGAWEGLFLRAASDEEHPGAWVILAQTRGRMHPGERIVLRDRSDVDAGMLHLVGRTAGGGWLAMPDEQG… |
| A0A7W0X5Q0 | 37-350 | RTKSRLLHVDGERLADFAFADLPGLVPAGDLIVCNDTRVINARVHAQKTTGGKVELLVERIVASDEAWVQLRASHTPQSGASLTLPG… |
| A0A6A0ASZ2 | 248-599 | None |
| A0A5C8KMZ1 | 366-705 | None |
| R7QLU8 | 4-252 | None |
| A0A850QRJ9 | 5-188 | None |
| A0A525VXQ4 | 10-256 | None |
| A0A1M3SZH3 | 27-330 | None |
| A0A812NKX3 | 25-328 | None |
| A0A5B8MXY8 | 21-527 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.