DPCstruct | MC22163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 81 ± 15 aa |
| Standard deviation of domain lengths | 15.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20606 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401UF70 | 93-161 | REQAMAQEHLMLQNGQMYRIHNQQKTQLQQQLTLQDGAIVNPNGSVQTKDRKQLQLKNGECLDMNGNRY |
| A0A2W5GI79 | 21-100 | TAKKHDKASCAAPTEKAENYVMMYKGKMMKIVDGTPSPMTETVKLNNGAKVNTDGSVNLPDGKKIKIRENEMVTMSGKMS |
| A0A1G1T903 | 27-113 | None |
| A0A1G1SUH1 | 3-73 | None |
| B4CUU2 | 133-195 | None |
| B4D5W6 | 12-134 | None |
| A0A525WCF7 | 1-61 | None |
| A0A3E1NWB9 | 5-75 | None |
| A0A7V9H9J2 | 14-96 | None |
| A0A7K3XK18 | 95-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.