DPCstruct | MC22160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 230 ± 28 aa |
| Standard deviation of domain lengths | 28.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 20.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W6K6K3 | 1-180 | MEQFKDFFADLKERVSSPLISSFVISWLLINWPITVGLLLYKQQDLKADGFRSYYELIKGYSNWTYTALIPFLLALIYTFAFPYLKA… |
| A0A5S3N729 | 4-257 | ITELLETIFSTANQRIKSPFFGSFIFSWIIINWKPIFYFLLSDDKINTKINIIQDKYEFFQNSLLYPLLLSFIYVVVFPYINQFIHW… |
| A0A7Y4BGK6 | 1-221 | None |
| A0A6L4XR13 | 3-191 | None |
| A0A653XXF7 | 2-185 | None |
| A0A0H4VPY0 | 1-215 | None |
| A0A4P8U0E8 | 62-313 | None |
| A0A5C9C503 | 1-227 | None |
| A0A661IQX4 | 1-238 | None |
| A0A0T9L9S8 | 1-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.