DPCstruct | MC2216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 134 ± 9 aa |
| Standard deviation of domain lengths | 9.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9MQK8 | 28-175 | TTDSKKIEVIEVTGKRPVSFFKKLVNSAELNFYELYNDITTNRKFKVECKQVARHSFSRIKERKCIPAFADIAMFEQMDLMNSLRAP… |
| A0A2W4QEF4 | 2-124 | ARLEDEFYRRYNELNSNDLYDVYCAVEARTGTRLERRYCRPVFEIRALQAEGSEHWYALERATDKFFPQAWNAPLPALLTTETMKRD… |
| A0A2D8AL35 | 12-133 | None |
| A0A847D9B8 | 26-169 | None |
| A0A2E9J3E4 | 7-128 | None |
| A0A383B444 | 31-158 | None |
| A0A349E7P4 | 56-194 | None |
| A0A4Q3XUH0 | 40-164 | None |
| A0A1G0JUX6 | 94-233 | None |
| A0A5B7YBG5 | 22-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.