DPCstruct | MC22156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 124 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7RH18 | 1-120 | PTLFSNPVIANGLIVSRLAGAVLVVPLMEELFWRSFILRYLIDNQFMKVSIGQFTWFSCIACAVLFGLEHHLIGAGIMAGLAYNFLL… |
| A0A3D3W7L8 | 1-134 | MNLSDWLPARAGFQFDLQRMTAGDAVFLGVRFLGLAVVVPLAEELCWRGFLAPWLVNEDFQRVPAGQMTATSFCIVLGVFTSMHPEI… |
| A0A3L7V7B8 | 123-248 | None |
| A0A534Q5B2 | 68-196 | None |
| A0A517ZTA5 | 196-328 | None |
| B8JEG6 | 428-546 | None |
| A0A353Y0S2 | 78-196 | None |
| X0W860 | 26-154 | None |
| A0A1W9UFD7 | 95-211 | None |
| A0A831LJL8 | 51-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.