DPCstruct | MC22154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 132 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.42 |
| Pfam Score | 98.61 |
| Assigned Pfam label(s) | CL0056- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A556V9Z2 | 24-130 | SQIEVYPKHGSVSGVFHAGLSGVYAFNASVAREVCERLGVAMADKPQVEKALALGLQTCRFGWIDEQVVVIPRIQAKASCGQGGLGI… |
| L5L6F4 | 6-115 | LEGVVFPYHPRGGRYKLTFTEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVSQPREPCGGAGSAGVGEGANGGV… |
| A0A4W6EB47 | 84-215 | None |
| A0A6C0JEK5 | 300-410 | None |
| A0A3Q1GHL4 | 19-117 | None |
| H0ZCB4 | 14-119 | None |
| A0A2E4IFF8 | 57-171 | None |
| A0A1S3IKE4 | 32-135 | None |
| A0A4Z2ED34 | 82-182 | None |
| A0A1S3ID39 | 169-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.