DPCstruct | MC22152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 165 ± 24 aa |
| Standard deviation of domain lengths | 23.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.78 |
| Pfam Score | 90.75 |
| Assigned Pfam label(s) | PF05644- CL0056- PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7Z1R9 | 1-113 | MVMAVHSQTIQIPQCPNGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERNEMF… |
| L5KVT1 | 1-167 | MPFLYCNPGDVCYYASRNDKSYWLSTTAPLPMMPVAEDEIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPVGWRSLWIGYSFLMHTA… |
| F1QYN1 | 1533-1698 | None |
| A0A1I8FP47 | 432-603 | None |
| A0A5N5TGV9 | 184-390 | None |
| A0A553MUG1 | 191-355 | None |
| A0A2K5N9A6 | 320-487 | None |
| A0A673VRE0 | 105-272 | None |
| A0A183WI40 | 13-157 | None |
| A0A5B7FD54 | 42-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.