DPCstruct | MC22151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 211 ± 43 aa |
| Standard deviation of domain lengths | 43.03 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.25 |
| Pfam Score | 69.05 |
| Assigned Pfam label(s) | PF08165- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1VXI3 | 39-252 | EIDDGLGFLPTFGPCYVNLYGSPREFTGFPDPYEELNSGKGEGVAYRGRLLVELETKLVDHVEQKLGDIPADDILRVEKYLRRRKYN… |
| A0A3S5CUT5 | 1-102 | MRRRKYLLHCAFHSATLIGETDGPVEFEVSIGNYGNKLDGSVKPSSSTTQPTNAVYDGTYYHFLPWSESKPCTVVESHWEDISYRLG… |
| A0A6A5DFM3 | 5-175 | None |
| A0A817HM92 | 41-264 | None |
| G3NZL8 | 465-740 | None |
| A0A3M0LFF1 | 910-1126 | None |
| A0A1S3ID79 | 133-387 | None |
| A0A5E4BWA6 | 102-309 | None |
| A0A6S7HPN9 | 1-228 | None |
| A0A2B4S5W7 | 195-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.