DPCstruct | MC2215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497UB39 | 21-77 | AMFHPLGNAAVDCKGMSQSSCSGNSFCTWVKGYKAKSGKQVKGYCRAKPGKAKKSSK |
| A0A5Q0ELD2 | 12-71 | VFVMALSAASAVQANECKGLEEKKCLEAEACSWVKGYKTSSGSEVKSYCRNKPSKKKEKS |
| W6KPC9 | 8-72 | None |
| A0A2G6FL53 | 22-77 | None |
| A0A833D657 | 53-120 | None |
| A0A1E2USM0 | 19-74 | None |
| A0A349X5B5 | 64-130 | None |
| A0A285PDG1 | 19-87 | None |
| A0A357I9H8 | 1-65 | None |
| H8YZI6 | 16-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.