DPCstruct | MC22149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 120 ± 21 aa |
| Standard deviation of domain lengths | 20.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.54 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | CL0101- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804QEK2 | 2-125 | DKVTNPLFEKRPKQFGIGGALPPKKDLHRFVKWPKVVRIQRQRRILKQRLKVPPALNQFTRTLDKNLATNLFKMLLKYRPEDKAAKK… |
| L5KMM4 | 10-124 | TAKEKKAKGKKVAPASAVMKKQQAKKVVNPLFEKRPKNLGIGQDIQTKRDLTHFVKWPQYIQLQWQRDFLYKHLKVPPAINQFSQAL… |
| L9LBI6 | 8-118 | None |
| A0A2K5PEZ1 | 82-192 | None |
| A0A0R3RCR1 | 2-96 | None |
| F0UUX8 | 212-345 | None |
| A0A445E3D7 | 106-263 | None |
| A0A059CYF1 | 36-172 | None |
| A0A6A1USG6 | 52-146 | None |
| A0A7G2ETM9 | 1-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.