DPCstruct | MC22143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 106 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A326QKM9 | 1-102 | MNSPWQDTFSYLSDRGADYGITADELIASTPTFIQHDPHAVMSFWQQKDISHILPTSRHPELAGDFNNWIPEDPGPNHARQDQIMSW… |
| A0A1B1TU87 | 11-110 | EEQTYLDQRFTAHGLDPELAYDYLIPDVVKAQGPDAIEAFMRQKDISHIYPQSDYPELADQLNNVFLEDPDLNAARGDRLATPDEVW… |
| A0A6N8ZVM3 | 57-164 | None |
| A0A6B1F5J1 | 10-106 | None |
| A0A3Q9FPC2 | 35-143 | None |
| A0A7G8D3I3 | 58-162 | None |
| F5UL35 | 70-176 | None |
| A0A6L7QIY6 | 135-250 | None |
| A0A6L8IGU6 | 31-138 | None |
| A0A6N8ZLM9 | 3-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.