DPCstruct | MC22142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 8.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7E4J9 | 1-77 | MSISIADDQDKIAVFKGFSSSLMQSTAFDPDVPVLPDEATTISIDRIGSPYNPESPRYIQQGISWEAMEALLLEVGI |
| A0A1B1TRM1 | 12-104 | AKQLEAYTRKYAHEVLLLHLGHGEIEDQIIIFKGFSSSLMQPTDFNPDNPVLAEMPILRIDRLQSPYNPNQPIFLEQNLSLEKMQRY… |
| A0A218QJW3 | 56-137 | None |
| A0A7R9SVJ5 | 99-194 | None |
| K9YR26 | 10-91 | None |
| N1QXW8 | 614-695 | None |
| A0A1R3GRH4 | 240-332 | None |
| A0A118JY12 | 165-263 | None |
| A0A0K9S3A4 | 2-83 | None |
| A0A2I0AKL5 | 79-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.