DPCstruct | MC22140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 225 ± 20 aa |
| Standard deviation of domain lengths | 20.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5WRB2 | 2-196 | DIIITGIRKLKTASLLQIISVILLLVAVFTLWGVLFAFSLEAILATGILGVVIMFIAVILAFIAVFAYLVPSAGDLAKWRPDEFSTP… |
| T0LP82 | 1-222 | MDRVVGQDPIAKTSSELEALRNIRTFSILSFFGFATDAVVAILALLSLPKLLTSFPTPSSAHTASFVSLGIAFSLGGLGIAAALLMI… |
| A0A0F7FH19 | 1-264 | None |
| L0HLH7 | 3-207 | None |
| A0A348B656 | 1-244 | None |
| A0A7C5BH31 | 32-257 | None |
| A0A2R6BJL4 | 2-217 | None |
| A0A7C4NNI1 | 6-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.