DPCstruct | MC22139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 15.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S4VH50 | 3-149 | QEEQLTAWDALGLNYGDFISHADLRRTLGLERPFPEKYPSIPEYDAARDDYEWQVLRSVNELRELLLTERKIYLDIKRGHGYEMAHP… |
| A0A1A2MYH5 | 1-156 | MSPFEPKGETARWRILYRLLSQTEVDDILTYEDMASALELDPEVDRHTIQVAMRRAASELEKVEKHAVEAVKNVGYRVVEPEEHLRL… |
| A0A0F9IK88 | 24-180 | None |
| A0A2E6PST0 | 3-148 | None |
| A0A382SL08 | 11-141 | None |
| A0A8B5WXC0 | 1-147 | None |
| A0A661CWZ5 | 1-139 | None |
| A0A0F9PE54 | 22-175 | None |
| X0TI44 | 12-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.