DPCstruct | MC22137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 8.35 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A136JMR6 | 135-227 | GAAPNKIWKAINNGVVLELENERSVRELRPDFHAIAQLGYERVYVTAPGETCDLASRMFAPRIGVQEDPVTGAMHCTLVPYWAKRLG… |
| A0A1I2UZ37 | 1-79 | MLVLDRKEDVINFIPDYSKIMEVTEGMGLFITAPSKDYDFVSRTFFPKIKVNEDPVCESAHCNLIPYWSKRLGKDKMTA |
| A0A2K1IYZ2 | 314-390 | None |
| A0A2A2KK21 | 145-232 | None |
| A0A2N9G7Y0 | 351-425 | None |
| A0A7S3PFG4 | 29-125 | None |
| A0A830CDZ7 | 166-244 | None |
| A0A4S4EAT8 | 182-258 | None |
| A0A0P8BJS2 | 163-261 | None |
| A0A5A7P1V2 | 463-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.