DPCstruct | MC22136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 219 ± 63 aa |
| Standard deviation of domain lengths | 62.74 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 80.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF07839- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6LK75 | 3-229 | SMKWDVKVLCLTASVCRRLRATAKRLLWRELCLFRAPRITESLSNGVHSSRMLGGWPSLAKLLFFCGGCNSTRNFVMSRSKPGHFVA… |
| A0A5P1EFC5 | 117-253 | FCSGSSSSSVPGHFVQVSRFSKTSGKSFLHKRCHGDLLYVSDPCEHCVAGGDEEEDLGMYRGVFRGFMRSRTRACLISKQARLENRV… |
| A0A7J7G8I8 | 190-415 | None |
| A0A7J7G966 | 266-467 | None |
| A0A1R3H0F1 | 506-653 | None |
| A0A6A6MMH1 | 1-175 | None |
| A0A5N6NIL3 | 173-406 | None |
| A0A7J8LQI2 | 1-149 | None |
| A0A427B5U5 | 243-470 | None |
| A0A164YZM1 | 1-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.