DPCstruct | MC22135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 396 ± 94 aa |
| Standard deviation of domain lengths | 94.37 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09737 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G1Q1Y9 | 21-326 | PLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIHVFQVTPEGTFIDVRTIGRFCYEDDLLTVSAIFP… |
| A0A5N6LGL5 | 537-1031 | MFRRHNITSRIFERQIRTPAPGTSVHCARRFYENIVPSSTIYDVECPDHSFRKFTEDGKYLISFSRNHHDLIVYRPTWLMFSYRQED… |
| A0A5B8MJ93 | 112-553 | None |
| A0A016TXN4 | 2-247 | None |
| A0A446PQZ8 | 9-370 | None |
| A0A1B0BUS7 | 30-560 | None |
| A0A068V0V0 | 3-259 | None |
| A0A7R8X7Y3 | 78-543 | None |
| A0A445D6Z2 | 4-312 | None |
| A0A2H9TN02 | 3-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.