DPCstruct | MC22134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 158 ± 26 aa |
| Standard deviation of domain lengths | 26.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6L7L0 | 5-164 | EHSGKSSWFARQIKFKYRKRWVNFQPQQPERYYLPEIDAQSMKHKVILKWLPPRVMKTIPLRKMRQDFGSSFRLWYFDGRNSEAVIV… |
| A0A6S7LPW1 | 372-556 | MWVVKRNLGVPEYYKSTPDFNSWTKVDLVELLRAPFHNPSEDPSASIFKRFLDRQVKENFLSMKTERALYRKEKEILDPESGEPMKI… |
| A0A2J6M4X4 | 105-256 | None |
| A0A5N6PV77 | 136-300 | None |
| A0A5N6PP00 | 25-203 | None |
| A0A5N6PD69 | 1-126 | None |
| A0A6S7NFS8 | 54-204 | None |
| A0A6S7PVV1 | 208-384 | None |
| A0A6S7PTI7 | 3-150 | None |
| A0A6S7PN48 | 7-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.