DPCstruct | MC22133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 125 ± 20 aa |
| Standard deviation of domain lengths | 19.55 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4X669 | 3-99 | MLGGYRWVNGKLYYKPEALKSFGLLKMEDEDDTEYISLRKLYWFSVPRNDLFVIGILSEEGVKPCIERPCTGTISFFDRRLGGDIDN… |
| A0A6A3LB05 | 1-121 | MHGSLSLLVTPCCVDTTLGSCCKSILLSGYVWEDGRLCYTTDTLKSFGLMKMTEDNGAQYLVLYKLHWMAIPRTDLVVIGEVNGHIV… |
| W2IJB1 | 1124-1245 | None |
| A0A0W8C7D3 | 192-309 | None |
| A0A0W8B5E9 | 138-282 | None |
| W2ZJC9 | 833-956 | None |
| A0A662XNE3 | 850-991 | None |
| V9FG31 | 410-532 | None |
| A0A6A3KRJ2 | 1-174 | None |
| A0A6A3KM88 | 179-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.