DPCstruct | MC22132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 99 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6VVM2 | 124-218 | GFYDGLSLDVPIVNMLPGSVEETPSIGSRYKVEILVKVLDPRCTKRVFYRLKDGSTTTDDPVVMKTFVHVEDPETFCFCMKWKHDYN… |
| W2MG77 | 2-80 | NIHIESVSEHPVVQDRFEIKLVIRAICIEHGRLILDRLKEGVEVSADGLEMRTSVYVTNPIGFCACMDWRHAQIAERWE |
| A0A4Q5VHQ4 | 89-213 | None |
| A0A507CVW9 | 181-277 | None |
| A0A485KFS0 | 66-150 | None |
| F4P594 | 6-101 | None |
| A0A6A3MKZ9 | 1-88 | None |
| A0A6G0S807 | 282-372 | None |
| A0A483A4W7 | 233-340 | None |
| W2PY69 | 603-700 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.