DPCstruct | MC22131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S2GZU2 | 1-128 | MADGLDLRAGDLERGLALIDEIPEAVLLAGDLALRDWVTSTHPELVTTSRADIVGCAGAIAWLIASTAIPAAKILKIKRLIEGLGGV… |
| A0A3E0WIC9 | 47-211 | LSQNSDFVNFLDGVEQLPSFIIEQGPEKTANWLSEKTGVEVTTDGQNLYLPSLANVNLEDNQSLVESRITTFSTWGCVTAIGLMIGS… |
| A0A7X1BYY8 | 107-269 | None |
| A0A0F5IAC6 | 4-156 | None |
| A0A850BTL8 | 19-159 | None |
| W2E3Y9 | 2-135 | None |
| K9ADC7 | 1-157 | None |
| A0A1N7B3P8 | 84-246 | None |
| A0A1H3HBB1 | 45-224 | None |
| A0A1Q8JZA0 | 44-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.