DPCstruct | MC22130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 201 ± 31 aa |
| Standard deviation of domain lengths | 30.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3ZIR5 | 57-212 | GNRTVRIQTKQSADYRFGVTGLLSATDAPTDAVDAGKASATLERGVHEFQFSGEFTEFELNGEAKVTVNGEPFDVAAFPHNTLKIIP… |
| A0A2R6FZ21 | 53-244 | GDVIEEGGDCGDSNPDDGPDNPEDLDHHLVIEPLDDDPGRYTLYFDAGKPVMYGEDADNEDGSDVISSAYASGTINRGTDDYYYNGG… |
| A0A2R6JK48 | 216-421 | None |
| A0A3P3RKH2 | 349-517 | None |
| A0A256HPF0 | 351-596 | None |
| A0A3P3RKR7 | 23-272 | None |
| V4IYQ5 | 27-277 | None |
| L9W8N5 | 7-205 | None |
| A0A2R6IF56 | 172-369 | None |
| A0A3A5JJH7 | 67-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.