DPCstruct | MC22129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 298 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 74.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B8ZSF8 | 1-338 | MKRGAHYILVVCVLLFGTGLYSLNADYLIFTSEVPELTELEPQVVLEGDSLDPRYPVAKTVPEAYDDLIKKSPMDLRNPDNVKTSIE… |
| A0A4Q6D1J8 | 1-264 | MQLPNPPSIVDAYTYDPVTNRYIYTSKVEDFNINYPIILTPEEYQQLVQREAIRGYFKQKSDAISGKNEQGKKDLLPRYYVNSGFFE… |
| A0A090VRN6 | 1-272 | None |
| A0A2G1C1J5 | 4-296 | None |
| A0A351PY55 | 1-297 | None |
| A0A136MIP6 | 17-314 | None |
| A0A1F4XUP4 | 8-309 | None |
| A0A660Z5W4 | 55-374 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.