DPCstruct | MC22128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 137 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090SAS0 | 1-139 | MFEFEPVVDFDLLPLLTFATPHIAGYGLEGKARGTTMIFNSYCEFLGLSERANPDALLPVAPIPELTLDRAWDEAALHSLTQIIYDV… |
| A0A3B8ZQM5 | 1-149 | AKREGIVSELIIDCWENEPHIDLQLLDAASIATPHIAGFSADGKANGTRACLQTIGNFFRIPIEKIGEVVPPLPEEPVIDLDLFTSR… |
| A0A836WML2 | 137-272 | None |
| G5SN68 | 124-240 | None |
| A0A1G0HYP8 | 1-126 | None |
| A0A7Y2B013 | 159-273 | None |
| R7D0I5 | 12-137 | None |
| A0A836VWE0 | 21-179 | None |
| W9URL3 | 52-197 | None |
| A0A7C0WJ31 | 310-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.