DPCstruct | MC22127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 4.83 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.64 |
| Pfam Score | 92.98 |
| Assigned Pfam label(s) | CL0039- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8P2D4 | 29-110 | MAVLDPVKIVIENFEGEETLEIANHPNKPEMGSREVPFTREIFIEADDFREEANKKYKRLVLGKEVRLRGAYVIKAERIEKD |
| A0A3B8ZP79 | 1-78 | PVKLIITNYPEGKVEMMEAINNPEDLTQGSHEIAFSRELFIEREDFMEDAPKKFFRMTPGQEVRLKNAYIVKCTGCKK |
| A0A0K9Q857 | 1-84 | None |
| A0A151HCF9 | 591-672 | None |
| A0A485JLE9 | 125-204 | None |
| A0A7D8V1K4 | 650-729 | None |
| A0A817RCH4 | 47-138 | None |
| A0A7S4C865 | 523-604 | None |
| A0A820Q699 | 1-92 | None |
| A0A258VBS5 | 38-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.