DPCstruct | MC22122
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 379 ± 58 aa |
| Standard deviation of domain lengths | 58.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 28.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091E101 | 108-429 | APHLFAQLSKVLKLSKVQEVIFGLALLNSSSSDLRGFAAQFIKQKLPDLLRSYIDADVSGNQEGGFQDIAIEVLHLLLSHLLFGQKG… |
| A0A7J7I480 | 1-322 | MMISEQLLTDFCDELHLSASEKIGIGLALADSENVDIRTSGQNFCMGQIEELWRNSAVIDSSVQIQNIIMFLISSEGLSKHVDSFMQ… |
| A0A816NGH5 | 8-387 | None |
| A0A2V2WGD0 | 15-436 | None |
| A0A2G8LNY9 | 1-444 | None |
| A0A446IZM3 | 1-445 | None |
| A0A3Q0JJY2 | 1-286 | None |
| A0A4D9A7B5 | 8-279 | None |
| A0A2K3PLI5 | 5-455 | None |
| K7VY55 | 1-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.