DPCstruct | MC2212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 328 ± 24 aa |
| Standard deviation of domain lengths | 24.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1CF72 | 80-401 | LQTPRWTYNPPEGKREIAGTLGEIRGEIKDGDSPVWFHNGLDIVGGYGETARFVRTEKVLRPAAVENFNTSRELIRMPTLGYIHIRL… |
| A0A0S8FPU6 | 11-336 | LSVGWPLAPQDSMHACCDYYAAYREGSGGDIDLHTSIDVWCDTSGVPVYAVADGYVKVWVNTWGGSPYGWGLGIGDEYGTDSMNVWS… |
| A0A7W0QB02 | 80-416 | None |
| A0A7W0P953 | 5-317 | None |
| A0A2W2BDQ3 | 92-419 | None |
| A0A538L9K6 | 6-300 | None |
| A0A256W5X0 | 11-299 | None |
| A0A2E0CI52 | 314-635 | None |
| A0A7Y2DW89 | 181-506 | None |
| A0A7X7J3M7 | 263-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.