DPCstruct | MC22118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 110 ± 28 aa |
| Standard deviation of domain lengths | 27.77 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9RQE3 | 91-186 | SIGDLKKILSVIKDIEFILQEKYKIASDRPGSGNTKNIGSTTKIEQMRGGSGIFSKYGIEVFDDYWMYYLTKDMARVLELPKPPYRN… |
| A0A8B3S417 | 27-122 | SIDDLKRIISVVKDVEFIVQEKYKIASDKPGSGNTKNIGSAKKIEQIRIGAGIFSEYGMSVFDDYWMYYMTRDMAHQLDLPKPPYRN… |
| X1N8F2 | 1-88 | None |
| R7J2P1 | 1-96 | None |
| A0A7D6FJ55 | 216-318 | None |
| F0F6K1 | 2-133 | None |
| I9YX69 | 11-147 | None |
| A0A2A3HEB2 | 64-225 | None |
| R9M6W0 | 168-240 | None |
| A0A5J4R0V2 | 16-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.