DPCstruct | MC22117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662J8N1 | 4-107 | EEVVSKVLALKPHEPIAIPKGQLPPPSQAGFKLSVGGPRGQLADYRLKLKDGRSIHVVEFKDRYEVHWDLADPEEKPLSHLAVDSPK… |
| A0A812A3A8 | 9-111 | VSKLRKLLERKQFGENITIPKRDMQIPSGCRETLLGDPNGSHKQYRCDQNDQNIHILEYDDRYEVHKDRVDPRKDPLGHLISDSPET… |
| A0A6B0T3C0 | 61-165 | None |
| A0A6G3ZEC0 | 66-166 | None |
| A0A2P6VWX2 | 7-91 | None |
| A0A538QN34 | 2-113 | None |
| A0A842X0W9 | 4-104 | None |
| A0A2E0TRG4 | 2-109 | None |
| A0A2R6ESP8 | 19-122 | None |
| A0A521U6E4 | 14-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.