DPCstruct | MC22116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 172 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832Z2U2 | 30-208 | MVEEDLARPVIEVIDFDTKRIEYEIYTYGEEVIIMPVKYEEIESIKRMIEEVIRKYVTDYEIEVVSNNKAIVKVPENEISNLLGKKG… |
| A0A811T3T1 | 26-186 | YTYGEQVIVMPATVEEPFDEEGLKEMVTSEIEKHARKPFEINILSKRKAVILCTESDIPALIGRGGRNIEKIEKRVGMRLDVRPDKT… |
| A0A832RJ52 | 194-367 | None |
| C9RI22 | 1060-1242 | None |
| A0A2U3CKV0 | 445-619 | None |
| A0A7K4C532 | 2-148 | None |
| A0A838TZX0 | 1-179 | None |
| A0A0B3ACV9 | 771-942 | None |
| A0A7K3Y4A8 | 117-291 | None |
| A0A843HBV9 | 75-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.